PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn266031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 227aa    MW: 25103.4 Da    PI: 7.4606
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn266031genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.93.6e-4371061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk++rrkC+++Cv+apyfp +qp+kf+ vhk+FGasnv+k+l++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lqq+l+q++ +l  +k+
  Achn266031   7 PCAACKLQRRKCTQECVFAPYFPPDQPQKFETVHKVFGASNVSKILNDLSAAQREDAVNSLAYEAEARLRDPVYGCVGLISILQQRLKQVQIDLYNAKK 105
                 7*******************************************************************************************9998887 PP

      DUF260 100 e 100
                 e
  Achn266031 106 E 106
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9556107IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-427103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MSTTASPCAA CKLQRRKCTQ ECVFAPYFPP DQPQKFETVH KVFGASNVSK ILNDLSAAQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ QRLKQVQIDL YNAKKELAAY IGPSAMFPIL  120
QTPNNPAFHA HQPSQQQILD AQQMAAVLAA REQQEVSRFN QMNAASLGLG SFDPIQQISP  180
QEQWHQIQIQ SEVLVQQQPA MGARQQERAG SRSEEGRGVV HRVDAF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263109.27e-75PREDICTED: LOB domain-containing protein 36-like
RefseqXP_003635533.23e-75PREDICTED: LOB domain-containing protein 36-like, partial
SwissprotQ9FKZ36e-69LBD36_ARATH; LOB domain-containing protein 36
TrEMBLF6H7Q88e-75F6H7Q8_VITVI; Putative uncharacterized protein
STRINGVIT_07s0197g00020.t012e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-70ASYMMETRIC LEAVES 2-like 1